Results of Nuclear Localization Signal Prediction(NLS):

  • Help on interpretation of results.


  • Input Sequence (NLS's in Red)
    MDQNLSGLDCLSEPDEKRWPDGKRKRKNSQCMGKSGMSGDSLVSLPPAGYIPSYLDKDEP
    CVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDGCCIIDKITRNQCQLCRF
    KKCIAVGMAMDLVLDDSKRVAKRKLIEENRVRRRKEEMIKTLQQRPEPSSEEWELIRIVT
    EAHRSTNAQGSHWKQRRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDF
    AKKLPMFSELTCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLSGEMAVKREQLKNGGL
    GVVSDAIFDLGRSLAAFNLDDTEVALLQAVLLMSSDRTGLICTDKIEKCQETYLLAFEHY
    INHRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV
    Sequence Length418
    NLS's found. No gives position of Motif
    • RRTIQKN 85
    • RRTIQKN 85
    • SKRVAKRKL 136
    • KRVAKRKL 137
    • KRKLIEENRVRRR 141
    • WKQRRKF 192

    Statistical data for Nuclear Localization Signals present in the Input Sequence

    Generalized NLS
    ( notation )
    TypeNo with NLS%Nuc Proteins%NonNuc ProteinsProtein Swiss IdProtein Localizations(Swiss anno.)
    K[RK]{2,}?[QL]x{3,8}R{3} Potential 23 100 0 tha_chick nuc
    thb_chick nuc
    ato_drome nuc
    trsf_drome nuc
    nr54_human nuc
    tha1_human nuc
    tha2_human nuc
    thb1_human nuc
    thb2_human nuc
    tha1_mouse nuc
    tha2_mouse nuc
    thb1_mouse nuc
    thb2_mouse nuc
    tha2_rat nuc
    tha_ranca nuc
    thb1_rat nuc
    thb2_rat nuc
    prt1_scyca nuc
    tha1_sheep nuc
    thb1_sheep nuc
    thaa_xenla nuc
    thab_xenla nuc
    cha4_yeast nuc
    [KR]{2,3}xxKR[KR][QLM] Potential 31 100 0 ctcf_chick nuc
    tha_chick nuc
    thb_chick nuc
    elf1_drome nuc
    ak95_human nuc
    ctcf_human nuc
    nol1_human nuc
    tha1_human nuc
    tha2_human nuc
    thb1_human nuc
    thb2_human nuc
    ve1_hpv33 nuc
    ve2_hpv48 nuc
    mx1_mouse nuc
    tha1_mouse nuc
    tha2_mouse nuc
    thb1_mouse nuc
    thb2_mouse nuc
    ak95_rat nuc
    mx1_rat nuc
    tha2_rat nuc
    tha_ranca nuc
    thb1_rat nuc
    thb2_rat nuc
    thb_ranca nuc
    cc21_schpo nuc
    tha1_sheep nuc
    thb1_sheep nuc
    thaa_xenla nuc
    thab_xenla nuc
    pus4_yeast nuc
    WKQ[KR]RKF Potential 18 100 0 tha_chick nuc
    thb_chick nuc
    tha1_human nuc
    tha2_human nuc
    thb1_human nuc
    tha1_mouse nuc
    tha2_mouse nuc
    thb1_mouse nuc
    thb2_mouse nuc
    tha2_rat nuc
    tha_ranca nuc
    thb1_rat nuc
    thb2_rat nuc
    thb_ranca nuc
    tha1_sheep nuc
    thb1_sheep nuc
    thaa_xenla nuc
    thab_xenla nuc
    SKRVAKRKL Experimental 9 100 0 tha_chick nuc
    tha1_human nuc
    tha2_human nuc
    tha1_mouse nuc
    tha2_mouse nuc
    tha2_rat nuc
    tha_ranca nuc
    tha1_sheep nuc
    thab_xenla nuc
    RR[TS]x[QK][KR][KN] Potential 35 100 0 vdr_bovin nuc
    tha_chick nuc
    thb_chick nuc
    vdr_chick nuc
    vdr_cotja nuc
    dnl4_human nuc
    rrb2_human nuc
    rrg1_human nuc
    rrg2_human nuc
    tha1_human nuc
    tha2_human nuc
    thb1_human nuc
    thb2_human nuc
    vdr_human nuc
    rra_mouse nuc
    rrb_mouse nuc
    rrg1_mouse nuc
    rrg2_mouse nuc
    tha1_mouse nuc
    tha2_mouse nuc
    vdr_mouse nuc
    rra_notvi nuc
    rrb_notvi nuc
    tha2_rat nuc
    tha_ranca nuc
    thb_ranca nuc
    vdr_rat nuc
    tha1_sheep nuc
    thb1_sheep nuc
    rra_xenla nuc
    rrg1_xenla nuc
    rrg2_xenla nuc
    thaa_xenla nuc
    thab_xenla nuc
    vdr_xenla nuc
    RR[TS]x[QK][KR][KNS] Potential 41 100 0 vdr_bovin nuc
    tha_chick nuc
    thb_chick nuc
    vdr_chick nuc
    vdr_cotja nuc
    dnl4_human nuc
    rrb2_human nuc
    rrg1_human nuc
    rrg2_human nuc
    tha1_human nuc
    tha2_human nuc
    thb1_human nuc
    thb2_human nuc
    vdr_human nuc
    hmgt_mouse nuc
    rra_mouse nuc
    rrb_mouse nuc
    rrg1_mouse nuc
    rrg2_mouse nuc
    tha1_mouse nuc
    tha2_mouse nuc
    thb1_mouse nuc
    thb2_mouse nuc
    vdr_mouse nuc
    rra_notvi nuc
    rrb_notvi nuc
    tha2_rat nuc
    tha_ranca nuc
    thb1_rat nuc
    thb2_rat nuc
    thb_ranca nuc
    vdr_rat nuc
    h1s_strpu nuc
    tha1_sheep nuc
    thb1_sheep nuc
    rra_xenla nuc
    rrg1_xenla nuc
    rrg2_xenla nuc
    thaa_xenla nuc
    thab_xenla nuc
    vdr_xenla nuc

    This protein is predicted to bind to DNA.

    DNA Binding signals. RR[TS]x[QK][KR][KN]

    DNA binding statistics for the binding NLS signals.

    DnaBindNLS No binding DNA %binding DNA No in binding Domain %in binding Domain % of associated DNA binding domains
    RR[TS]x[QK][KR][KN] 34 97.14 34 100 ZINC FINGERS: 100

    Symbols used in representing the NLS are explained below:

    An x (or X) implies any amino acid residue can be present at this position.

    Example Motifs
    Example Read Equivalent Motifs
    [KR]KRKK "K or R" KRKK KKRKK,RKRKK
    K{5} 5 times K KKKKK
    [KR]{3,5} between 3 and 5 times K or R KKRR, RRKKR, RRR,KKK ...
    K{3,}? 3 or more K's KKK,KKKK,KKKKK ...