| Input Sequence (NLS's in Red) |
CEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQE |
| Sequence Length | 40 |
| NLS's found. No gives position of Motif |
|
|
Generalized NLS ( notation ) |
Type | No with NLS | %Nuc Proteins | %NonNuc Proteins | Protein Swiss Id | Protein Localizations(Swiss anno.) | ||||
| RR[TS]x[QK][KR][KNS] | Potential | 41 | 100 | 0 | vdr_bovin | nuc | ||||
| tha_chick | nuc | |||||||||
| thb_chick | nuc | |||||||||
| vdr_chick | nuc | |||||||||
| vdr_cotja | nuc | |||||||||
| dnl4_human | nuc | |||||||||
| rrb2_human | nuc | |||||||||
| rrg1_human | nuc | |||||||||
| rrg2_human | nuc | |||||||||
| tha1_human | nuc | |||||||||
| tha2_human | nuc | |||||||||
| thb1_human | nuc | |||||||||
| thb2_human | nuc | |||||||||
| vdr_human | nuc | |||||||||
| hmgt_mouse | nuc | |||||||||
| rra_mouse | nuc | |||||||||
| rrb_mouse | nuc | |||||||||
| rrg1_mouse | nuc | |||||||||
| rrg2_mouse | nuc | |||||||||
| tha1_mouse | nuc | |||||||||
| tha2_mouse | nuc | |||||||||
| thb1_mouse | nuc | |||||||||
| thb2_mouse | nuc | |||||||||
| vdr_mouse | nuc | |||||||||
| rra_notvi | nuc | |||||||||
| rrb_notvi | nuc | |||||||||
| tha2_rat | nuc | |||||||||
| tha_ranca | nuc | |||||||||
| thb1_rat | nuc | |||||||||
| thb2_rat | nuc | |||||||||
| thb_ranca | nuc | |||||||||
| vdr_rat | nuc | |||||||||
| h1s_strpu | nuc | |||||||||
| tha1_sheep | nuc | |||||||||
| thb1_sheep | nuc | |||||||||
| rra_xenla | nuc | |||||||||
| rrg1_xenla | nuc | |||||||||
| rrg2_xenla | nuc | |||||||||
| thaa_xenla | nuc | |||||||||
| thab_xenla | nuc | |||||||||
| vdr_xenla | nuc | |||||||||
| Example Motifs | ||
| Example | Read | Equivalent Motifs |
| [KR]KRKK | "K or R" KRKK | KKRKK,RKRKK |
| K{5} | 5 times K | KKKKK |
| [KR]{3,5} | between 3 and 5 times K or R | KKRR, RRKKR, RRR,KKK ... |
| K{3,}? | 3 or more K's | KKK,KKKK,KKKKK ... |