Results of Nuclear Localization Signal Prediction(NLS):

  • Help on interpretation of results.


  • Input Sequence (NLS's in Red)
    INKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVREEGSPDSYELSPQLEELIT
    Sequence Length58
    NLS's found. No gives position of Motif
    • DRNKKKK 29
    • DRNKKKKE 29
    • RNKKKKE 30

    Statistical data for Nuclear Localization Signals present in the Input Sequence

    Generalized NLS
    ( notation )
    TypeNo with NLS%Nuc Proteins%NonNuc ProteinsProtein Swiss IdProtein Localizations(Swiss anno.)
    [DE]RxKKKK Potential 15 100 0 ssrp_chick nuc
    t2d4_drome nuc
    ddx8_human nuc
    rrb2_human nuc
    rrg1_human nuc
    rrg2_human nuc
    rra_mouse nuc
    rrb_mouse nuc
    rrg1_mouse nuc
    rrg2_mouse nuc
    rra_notvi nuc
    rrb_notvi nuc
    rra_xenla nuc
    rrg1_xenla nuc
    rrg2_xenla nuc
    RxKKKK[DE] Potential 12 100 0 rrb2_human nuc
    rrg1_human nuc
    rrg2_human nuc
    rra_mouse nuc
    rrb_mouse nuc
    rrg1_mouse nuc
    rrg2_mouse nuc
    u2r1_mouse nuc
    rrb_notvi nuc
    rra_xenla nuc
    rrg1_xenla nuc
    rrg2_xenla nuc
    DR[MN]KKKKE Potential 11 100 0 rrb2_human nuc
    rrg1_human nuc
    rrg2_human nuc
    rra_mouse nuc
    rrb_mouse nuc
    rrg1_mouse nuc
    rrg2_mouse nuc
    rrb_notvi nuc
    rra_xenla nuc
    rrg1_xenla nuc
    rrg2_xenla nuc

    Symbols used in representing the NLS are explained below:

    An x (or X) implies any amino acid residue can be present at this position.

    Example Motifs
    Example Read Equivalent Motifs
    [KR]KRKK "K or R" KRKK KKRKK,RKRKK
    K{5} 5 times K KKKKK
    [KR]{3,5} between 3 and 5 times K or R KKRR, RRKKR, RRR,KKK ...
    K{3,}? 3 or more K's KKK,KKKK,KKKKK ...