| Input Sequence (NLS's in Red) |
INKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVREEGSPDSYELSPQLEELIT |
| Sequence Length | 58 |
| NLS's found. No gives position of Motif |
|
|
Generalized NLS ( notation ) |
Type | No with NLS | %Nuc Proteins | %NonNuc Proteins | Protein Swiss Id | Protein Localizations(Swiss anno.) | ||||
| [DE]RxKKKK | Potential | 15 | 100 | 0 | ssrp_chick | nuc | ||||
| t2d4_drome | nuc | |||||||||
| ddx8_human | nuc | |||||||||
| rrb2_human | nuc | |||||||||
| rrg1_human | nuc | |||||||||
| rrg2_human | nuc | |||||||||
| rra_mouse | nuc | |||||||||
| rrb_mouse | nuc | |||||||||
| rrg1_mouse | nuc | |||||||||
| rrg2_mouse | nuc | |||||||||
| rra_notvi | nuc | |||||||||
| rrb_notvi | nuc | |||||||||
| rra_xenla | nuc | |||||||||
| rrg1_xenla | nuc | |||||||||
| rrg2_xenla | nuc | |||||||||
| RxKKKK[DE] | Potential | 12 | 100 | 0 | rrb2_human | nuc | ||||
| rrg1_human | nuc | |||||||||
| rrg2_human | nuc | |||||||||
| rra_mouse | nuc | |||||||||
| rrb_mouse | nuc | |||||||||
| rrg1_mouse | nuc | |||||||||
| rrg2_mouse | nuc | |||||||||
| u2r1_mouse | nuc | |||||||||
| rrb_notvi | nuc | |||||||||
| rra_xenla | nuc | |||||||||
| rrg1_xenla | nuc | |||||||||
| rrg2_xenla | nuc | |||||||||
| DR[MN]KKKKE | Potential | 11 | 100 | 0 | rrb2_human | nuc | ||||
| rrg1_human | nuc | |||||||||
| rrg2_human | nuc | |||||||||
| rra_mouse | nuc | |||||||||
| rrb_mouse | nuc | |||||||||
| rrg1_mouse | nuc | |||||||||
| rrg2_mouse | nuc | |||||||||
| rrb_notvi | nuc | |||||||||
| rra_xenla | nuc | |||||||||
| rrg1_xenla | nuc | |||||||||
| rrg2_xenla | nuc | |||||||||
| Example Motifs | ||
| Example | Read | Equivalent Motifs |
| [KR]KRKK | "K or R" KRKK | KKRKK,RKRKK |
| K{5} | 5 times K | KKKKK |
| [KR]{3,5} | between 3 and 5 times K or R | KKRR, RRKKR, RRR,KKK ... |
| K{3,}? | 3 or more K's | KKK,KKKK,KKKKK ... |