Results of Nuclear Localization Signal Prediction(NLS):

  • Help on interpretation of results.


  • Input Sequence (NLS's in Red)
    RASGKHYGVYSCEGCKGFFKRTVRKDLTYACREERGCTIDKRQRNRCQYCRYQKCLRW
    Sequence Length58
    NLS's found. No gives position of Motif
    • DKRQRNR 39
    • KRQRNR 40

    Statistical data for Nuclear Localization Signals present in the Input Sequence

    Generalized NLS
    ( notation )
    TypeNo with NLS%Nuc Proteins%NonNuc ProteinsProtein Swiss IdProtein Localizations(Swiss anno.)
    [DE]KR[MQN]R[MQN]R Potential 13 100 0 rxra_chick nuc
    usp_drome nuc
    rxra_human nuc
    rxrb_human nuc
    rxrg_human nuc
    rxra_mouse nuc
    rxrb_mouse nuc
    rxrg_mouse nuc
    usp_manse nuc
    rrxb_rat nuc
    rxra_rat nuc
    rxra_xenla nuc
    rxrg_xenla nuc
    KR[MNSQ]R[MNSQ]R Potential 27 100 0 ap1_chick nuc
    ap1_cotja nuc
    rxra_chick nuc
    u2af_caebr nuc
    u2af_caeel nuc
    ap1_drome nuc
    usp_drome nuc
    h1l6_ensmi nuc
    ap1_human nuc
    ddx8_human nuc
    rxra_human nuc
    rxrb_human nuc
    rxrg_human nuc
    sfr3_human nuc
    ap1_mouse nuc
    rxra_mouse nuc
    rxrb_mouse nuc
    rxrg_mouse nuc
    usp_manse nuc
    ap1_pig nuc
    ap1_rat nuc
    rrxb_rat nuc
    rxra_rat nuc
    ap1_serca nuc
    rxra_xenla nuc
    rxrg_xenla nuc
    pop1_yeast nuc

    This protein is predicted to bind to DNA.

    DNA Binding signals. [DE]KR[MQN]R[MQN]R KR[MNSQ]R[MNSQ]R

    DNA binding statistics for the binding NLS signals.

    DnaBindNLS No binding DNA %binding DNA No in binding Domain %in binding Domain % of associated DNA binding domains
    [DE]KR[MQN]R[MQN]R 13 100 13 100 ZINC FINGERS: 100
    KR[MNSQ]R[MNSQ]R 21 77.77 21 100 ZINC FINGERS: 61.9BASIC DOMAIN: 38.09

    Symbols used in representing the NLS are explained below:

    An x (or X) implies any amino acid residue can be present at this position.

    Example Motifs
    Example Read Equivalent Motifs
    [KR]KRKK "K or R" KRKK KKRKK,RKRKK
    K{5} 5 times K KKKKK
    [KR]{3,5} between 3 and 5 times K or R KKRR, RRKKR, RRR,KKK ...
    K{3,}? 3 or more K's KKK,KKKK,KKKKK ...