| Input Sequence (NLS's in Red) |
RASGKHYGVYSCEGCKGFFKRTVRKDLTYACREERGCTIDKRQRNRCQYCRYQKCLRW |
| Sequence Length | 58 |
| NLS's found. No gives position of Motif |
|
|
Generalized NLS ( notation ) |
Type | No with NLS | %Nuc Proteins | %NonNuc Proteins | Protein Swiss Id | Protein Localizations(Swiss anno.) | ||||
| [DE]KR[MQN]R[MQN]R | Potential | 13 | 100 | 0 | rxra_chick | nuc | ||||
| usp_drome | nuc | |||||||||
| rxra_human | nuc | |||||||||
| rxrb_human | nuc | |||||||||
| rxrg_human | nuc | |||||||||
| rxra_mouse | nuc | |||||||||
| rxrb_mouse | nuc | |||||||||
| rxrg_mouse | nuc | |||||||||
| usp_manse | nuc | |||||||||
| rrxb_rat | nuc | |||||||||
| rxra_rat | nuc | |||||||||
| rxra_xenla | nuc | |||||||||
| rxrg_xenla | nuc | |||||||||
| KR[MNSQ]R[MNSQ]R | Potential | 27 | 100 | 0 | ap1_chick | nuc | ||||
| ap1_cotja | nuc | |||||||||
| rxra_chick | nuc | |||||||||
| u2af_caebr | nuc | |||||||||
| u2af_caeel | nuc | |||||||||
| ap1_drome | nuc | |||||||||
| usp_drome | nuc | |||||||||
| h1l6_ensmi | nuc | |||||||||
| ap1_human | nuc | |||||||||
| ddx8_human | nuc | |||||||||
| rxra_human | nuc | |||||||||
| rxrb_human | nuc | |||||||||
| rxrg_human | nuc | |||||||||
| sfr3_human | nuc | |||||||||
| ap1_mouse | nuc | |||||||||
| rxra_mouse | nuc | |||||||||
| rxrb_mouse | nuc | |||||||||
| rxrg_mouse | nuc | |||||||||
| usp_manse | nuc | |||||||||
| ap1_pig | nuc | |||||||||
| ap1_rat | nuc | |||||||||
| rrxb_rat | nuc | |||||||||
| rxra_rat | nuc | |||||||||
| ap1_serca | nuc | |||||||||
| rxra_xenla | nuc | |||||||||
| rxrg_xenla | nuc | |||||||||
| pop1_yeast | nuc | |||||||||
| DNA Binding signals. | [DE]KR[MQN]R[MQN]R | KR[MNSQ]R[MNSQ]R |
| DnaBindNLS | No binding DNA | %binding DNA | No in binding Domain | %in binding Domain | % of associated DNA binding domains |
| [DE]KR[MQN]R[MQN]R | 13 | 100 | 13 | 100 | ZINC FINGERS: 100 |
| KR[MNSQ]R[MNSQ]R | 21 | 77.77 | 21 | 100 | ZINC FINGERS: 61.9BASIC DOMAIN: 38.09 |
| Example Motifs | ||
| Example | Read | Equivalent Motifs |
| [KR]KRKK | "K or R" KRKK | KKRKK,RKRKK |
| K{5} | 5 times K | KKKKK |
| [KR]{3,5} | between 3 and 5 times K or R | KKRR, RRKKR, RRR,KKK ... |
| K{3,}? | 3 or more K's | KKK,KKKK,KKKKK ... |