Results of Nuclear Localization Signal Prediction(NLS):

  • Help on interpretation of results.


  • Input Sequence (NLS's in Red)
    LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKC
    YEAGMTLGARKLKKLGNLKLQEEGEASSATSPTEEPAQKLTVSHIEGYECQPIFLNVLEA
    IEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQY
    SWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQI
    TPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQL
    TKL
    Sequence Length303
    NLS's found. No gives position of Motif
    • DKFRRKN 44
    • DKFRRKN 44
    • RRKNCPSCRLRKCYEAGMTLGARKLK 47

    Statistical data for Nuclear Localization Signals present in the Input Sequence

    Generalized NLS
    ( notation )
    TypeNo with NLS%Nuc Proteins%NonNuc ProteinsProtein Swiss IdProtein Localizations(Swiss anno.)
    R[RK]{2,4}x{15,19}[RK]{2,4}[QLM]K Potential 7 100 0 andr_human nuc
    hxcc_human nuc
    andr_mouse nuc
    dbx_mouse nuc
    andr_rabit nuc
    andr_rat nuc
    rme1_yeast nuc
    [DE]K[NIF]RR[DEK][STMNQ] Potential 24 100 0 gcr_aotna nuc
    gcr_cavpo nuc
    prgr_chick nuc
    andr_human nuc
    gcr_human nuc
    mcr_human nuc
    prgr_human nuc
    andr_mouse nuc
    gcr_mouse nuc
    prgr_mouse nuc
    gcr_oncmy nuc
    gcr_parol nuc
    andr_rabit nuc
    andr_rat nuc
    gcr_rat nuc
    mcr_rat nuc
    prgr_rabit nuc
    gcr_sagoe nuc
    gcr_saibb nuc
    prgr_sheep nuc
    gcr_tupgb nuc
    mcr_tupgb nuc
    gcr_xenla nuc
    mcr_xenla nuc
    [DE]KxRRK[MNQ] Potential 23 100 0 gcr_aotna nuc
    prgr_chick nuc
    andr_human nuc
    gcr_human nuc
    mcr_human nuc
    prgr_human nuc
    andr_mouse nuc
    gcr_mouse nuc
    prgr_mouse nuc
    gcr_oncmy nuc
    gcr_parol nuc
    andr_rabit nuc
    andr_rat nuc
    gcr_rat nuc
    mcr_rat nuc
    prgr_rabit nuc
    gcr_sagoe nuc
    gcr_saibb nuc
    prgr_sheep nuc
    gcr_tupgb nuc
    mcr_tupgb nuc
    gcr_xenla nuc
    mcr_xenla nuc

    This protein is predicted to bind to DNA.

    DNA Binding signals. [DE]KxRRK[MNQ] [DE]K[NIF]RR[DEK][STMNQ]

    DNA binding statistics for the binding NLS signals.

    DnaBindNLS No binding DNA %binding DNA No in binding Domain %in binding Domain % of associated DNA binding domains
    [DE]KxRRK[MNQ] 23 100 23 100 ZINC FINGERS: 100
    [DE]K[NIF]RR[DEK][STMNQ] 24 100 24 100 ZINC FINGERS: 100

    Symbols used in representing the NLS are explained below:

    An x (or X) implies any amino acid residue can be present at this position.

    Example Motifs
    Example Read Equivalent Motifs
    [KR]KRKK "K or R" KRKK KKRKK,RKRKK
    K{5} 5 times K KKKKK
    [KR]{3,5} between 3 and 5 times K or R KKRR, RRKKR, RRR,KKK ...
    K{3,}? 3 or more K's KKK,KKKK,KKKKK ...