| Input Sequence (NLS's in Red) |
LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKC YEAGMTLGARKLKKLGNLKLQEEGEASSATSPTEEPAQKLTVSHIEGYECQPIFLNVLEA IEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQY SWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQI TPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQL TKL |
| Sequence Length | 303 |
| NLS's found. No gives position of Motif |
|
|
Generalized NLS ( notation ) |
Type | No with NLS | %Nuc Proteins | %NonNuc Proteins | Protein Swiss Id | Protein Localizations(Swiss anno.) | ||||
| R[RK]{2,4}x{15,19}[RK]{2,4}[QLM]K | Potential | 7 | 100 | 0 | andr_human | nuc | ||||
| hxcc_human | nuc | |||||||||
| andr_mouse | nuc | |||||||||
| dbx_mouse | nuc | |||||||||
| andr_rabit | nuc | |||||||||
| andr_rat | nuc | |||||||||
| rme1_yeast | nuc | |||||||||
| [DE]K[NIF]RR[DEK][STMNQ] | Potential | 24 | 100 | 0 | gcr_aotna | nuc | ||||
| gcr_cavpo | nuc | |||||||||
| prgr_chick | nuc | |||||||||
| andr_human | nuc | |||||||||
| gcr_human | nuc | |||||||||
| mcr_human | nuc | |||||||||
| prgr_human | nuc | |||||||||
| andr_mouse | nuc | |||||||||
| gcr_mouse | nuc | |||||||||
| prgr_mouse | nuc | |||||||||
| gcr_oncmy | nuc | |||||||||
| gcr_parol | nuc | |||||||||
| andr_rabit | nuc | |||||||||
| andr_rat | nuc | |||||||||
| gcr_rat | nuc | |||||||||
| mcr_rat | nuc | |||||||||
| prgr_rabit | nuc | |||||||||
| gcr_sagoe | nuc | |||||||||
| gcr_saibb | nuc | |||||||||
| prgr_sheep | nuc | |||||||||
| gcr_tupgb | nuc | |||||||||
| mcr_tupgb | nuc | |||||||||
| gcr_xenla | nuc | |||||||||
| mcr_xenla | nuc | |||||||||
| [DE]KxRRK[MNQ] | Potential | 23 | 100 | 0 | gcr_aotna | nuc | ||||
| prgr_chick | nuc | |||||||||
| andr_human | nuc | |||||||||
| gcr_human | nuc | |||||||||
| mcr_human | nuc | |||||||||
| prgr_human | nuc | |||||||||
| andr_mouse | nuc | |||||||||
| gcr_mouse | nuc | |||||||||
| prgr_mouse | nuc | |||||||||
| gcr_oncmy | nuc | |||||||||
| gcr_parol | nuc | |||||||||
| andr_rabit | nuc | |||||||||
| andr_rat | nuc | |||||||||
| gcr_rat | nuc | |||||||||
| mcr_rat | nuc | |||||||||
| prgr_rabit | nuc | |||||||||
| gcr_sagoe | nuc | |||||||||
| gcr_saibb | nuc | |||||||||
| prgr_sheep | nuc | |||||||||
| gcr_tupgb | nuc | |||||||||
| mcr_tupgb | nuc | |||||||||
| gcr_xenla | nuc | |||||||||
| mcr_xenla | nuc | |||||||||
| DNA Binding signals. | [DE]KxRRK[MNQ] | [DE]K[NIF]RR[DEK][STMNQ] |
| DnaBindNLS | No binding DNA | %binding DNA | No in binding Domain | %in binding Domain | % of associated DNA binding domains |
| [DE]KxRRK[MNQ] | 23 | 100 | 23 | 100 | ZINC FINGERS: 100 |
| [DE]K[NIF]RR[DEK][STMNQ] | 24 | 100 | 24 | 100 | ZINC FINGERS: 100 |
| Example Motifs | ||
| Example | Read | Equivalent Motifs |
| [KR]KRKK | "K or R" KRKK | KKRKK,RKRKK |
| K{5} | 5 times K | KKKKK |
| [KR]{3,5} | between 3 and 5 times K or R | KKRR, RRKKR, RRR,KKK ... |
| K{3,}? | 3 or more K's | KKK,KKKK,KKKKK ... |