| Input Sequence (NLS's in Red) |
RVKLVYERCERACKVQKKSRNKCQYCRFHK |
| Sequence Length | 30 |
| NLS's found. No gives position of Motif |
|
|
Generalized NLS ( notation ) |
Type | No with NLS | %Nuc Proteins | %NonNuc Proteins | Protein Swiss Id | Protein Localizations(Swiss anno.) | ||||
| KK[MNQSTC]R[MNQSTC]K[MNQSTC] | Potential | 12 | 100 | 0 | ppar_cavpo | nuc | ||||
| ppar_human | nuc | |||||||||
| ppas_human | nuc | |||||||||
| ppat_human | nuc | |||||||||
| ppar_mouse | nuc | |||||||||
| ppas_mouse | nuc | |||||||||
| ppat_mouse | nuc | |||||||||
| ppar_rat | nuc | |||||||||
| ppat_rabit | nuc | |||||||||
| ppar_xenla | nuc | |||||||||
| ppas_xenla | nuc | |||||||||
| ppat_xenla | nuc | |||||||||
| DNA Binding signals. | KK[MNQSTC]R[MNQSTC]K[MNQSTC] |
| DnaBindNLS | No binding DNA | %binding DNA | No in binding Domain | %in binding Domain | % of associated DNA binding domains |
| KK[MNQSTC]R[MNQSTC]K[MNQSTC] | 12 | 100 | 12 | 100 | ZINC FINGERS: 100 |
| Example Motifs | ||
| Example | Read | Equivalent Motifs |
| [KR]KRKK | "K or R" KRKK | KKRKK,RKRKK |
| K{5} | 5 times K | KKKKK |
| [KR]{3,5} | between 3 and 5 times K or R | KKRR, RRKKR, RRR,KKK ... |
| K{3,}? | 3 or more K's | KKK,KKKK,KKKKK ... |